Recombinant Human RCVRN Protein, GST-tagged

• Cat.No.: RCVRN-14H
• Product Overview: Human RCVRN partial ORF (NP_002894.1, 3 a.a. - 99 a.a.) recombinant protein with GST tag at N-terminal was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 3-99 a.a.
• Description: This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy.
• Molecular Mass: 36.3 kDa
• AA Sequence: NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RCVRN recoverin [ Homo sapiens (human) ]
• Official Symbol: RCVRN
• Synonyms: RCVRN; recoverin; RCV1; recoverin; cancer associated retinopathy antigen; cancer-associated retinopathy protein
• Gene ID: 5957
• mRNA Refseq: NM_002903
• Protein Refseq: NP_002894
• MIM: 179618
• UniProt ID: P35243