Recombinant Human RCAN2 Protein, GST-tagged

• Cat.No.: RCAN2-4031H
• Product Overview: Human DSCR1L1 full-length ORF ( AAH38509.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the regulator of calcineurin (RCAN) protein family. These proteins play a role in many physiological processes by binding to the catalytic domain of calcineurin A, inhibiting calcineurin-mediated nuclear translocation of the transcription factor NFATC1. Expression of this gene in skin fibroblasts is upregulated by thyroid hormone, and the encoded protein may also play a role in endothelial cell function and angiogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]
• Molecular Mass: 51.5 kDa
• AA Sequence: MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAACSFSIIAVSSLSCFFPLLFVKKNCL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RCAN2 regulator of calcineurin 2 [ Homo sapiens ]
• Official Symbol: RCAN2
• Synonyms: RCAN2; regulator of calcineurin 2; Down syndrome critical region gene 1 like 1 , DSCR1L1; calcipressin-2; ZAKI 4; Down syndrome candidate region 1-like 1; thyroid hormone-responsive protein ZAKI-4; Down syndrome critical region gene 1-like 1; thyroid hormone-responsive (skin fibroblasts); myocyte-enriched calcineurin-interacting protein 2; CSP2; RCN2; MCIP2; ZAKI4; ZAKI-4; DSCR1L1
• Gene ID: 10231
• mRNA Refseq: NM_001251973
• Protein Refseq: NP_001238902
• MIM: 604876
• UniProt ID: Q14206