Recombinant Human RBP4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RBP4-781H
Product Overview : RBP4 MS Standard C13 and N15-labeled recombinant protein (NP_006735) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.
Molecular Mass : 23 kDa
AA Sequence : MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RBP4 retinol binding protein 4 [ Homo sapiens (human) ]
Official Symbol RBP4
Synonyms RBP4; retinol binding protein 4, plasma; retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; retinol-binding protein 4, interstitial;
Gene ID 5950
mRNA Refseq NM_006744
Protein Refseq NP_006735
MIM 180250
UniProt ID P02753

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RBP4 Products

Required fields are marked with *

My Review for All RBP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon