Recombinant Human RBP2

Cat.No. : RBP2-30008TH
Product Overview : Recombinant fragment of Human RBP2 with N-terminal proprietary tag.Mol wt 35.53 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : RBP2 is an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. RBP2 may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle.
Molecular Weight : 35.530kDa inclusive of tags
Tissue specificity : Higher expression in adult small intestine and to a much lesser extent in fetal kidney.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
Sequence Similarities : Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Gene Name RBP2 retinol binding protein 2, cellular [ Homo sapiens ]
Official Symbol RBP2
Synonyms RBP2; retinol binding protein 2, cellular; retinol-binding protein 2; CRABP II; CRBP2; CRBPII; RBPC2;
Gene ID 5948
mRNA Refseq NM_004164
Protein Refseq NP_004155
MIM 180280
Uniprot ID P50120
Chromosome Location 3q23
Pathway Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Regulation of retinoblastoma protein, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem; Vitamin A uptake in enterocytes, organism-specific biosystem;
Function lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RBP2 Products

Required fields are marked with *

My Review for All RBP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon