Recombinant Human RBP2 protein, GST-tagged

• Cat.No.: RBP2-19H
• Product Overview: Recombinant Human RBP2(1 a.a. - 134 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 134 a.a.
• Description: This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 42.1 kDa
• AA Sequence: MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: RBP2 retinol binding protein 2, cellular [ Homo sapiens ]
• Official Symbol: RBP2
• Synonyms: RBP2; retinol binding protein 2, cellular; retinol-binding protein 2; CRABP II; CRBP2; CRBPII; RBPC2; CRBP-II; cellular retinol-binding protein II; retinol-binding protein 2, cellular; CRABP-II
• Gene ID: 5948
• mRNA Refseq: NM_004164
• Protein Refseq: NP_004155
• MIM: 180280
• UniProt ID: P50120
• Chromosome Location: 3q23
• Pathway: Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Regulation of retinoblastoma protein, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem; Vitamin A uptake in enterocytes, organism-specific biosystem; Vitamin digestion and absorption, organism-specific biosystem
• Function: lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity