Recombinant Human RBMX protein, GST-tagged

• Cat.No.: RBMX-3414H
• Product Overview: Recombinant Human RBMX protein(P38159)(333-391aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 333-391aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.4 kDa
• AA Sequence: DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RBMX RNA binding motif protein, X-linked [ Homo sapiens ]
• Official Symbol: RBMX
• Synonyms: RBMX; RNA binding motif protein, X-linked; RNA binding motif protein, X chromosome; RNA-binding motif protein, X chromosome; heterogeneous nuclear ribonucleoprotein G; hnRNP G; RNMX; glycoprotein p43; HNRPG; RBMXP1; RBMXRT; hnRNP-G
• Gene ID: 27316
• mRNA Refseq: NM_001164803
• Protein Refseq: NP_001158275
• MIM: 300199
• UniProt ID: P38159