Recombinant Human RBM6 protein, GST-tagged

• Cat.No.: RBM6-230H
• Product Overview: Recombinant Human RBM6 protein(NP_001161054)(302-601 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 302-601 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: LPEEEEIKEKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).

Gene Information

• Gene Name: RBM6 RNA binding motif protein 6 [ Homo sapiens ]
• Official Symbol: RBM6
• Synonyms: RBM6; RNA binding motif protein 6; RNA-binding protein 6; 3G2; DEF 3; DEF3; g16; NY LU 12; RNA-binding protein DEF-3; RNA-binding motif protein 6; lung cancer antigen NY-LU-12; lung cancer protooncogene 11; DEF-3; HLC-11; NY-LU-12; FLJ36517; FLJ39446; FLJ42036; DKFZp686B0877
• Gene ID: 10180
• mRNA Refseq: NM_001167582
• Protein Refseq: NP_001161054
• MIM: 606886
• UniProt ID: P78332