Recombinant Human RBM5, His-tagged

Cat.No. : RBM5-31232TH
Product Overview : Recombinant fragment, corresponding to amino acids 582-815 of Human RBM5 with an N terminal His tag. Observed mwt: 33 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 582-815 a.a.
Description : This gene is a candidate tumor suppressor gene which encodes a nuclear RNA binding protein that is a component of the spliceosome A complex. The encoded protein plays a role in the induction of cell cycle arrest and apoptosis through pre-mRNA splicing of multiple target genes including the tumor suppressor protein p53. This gene is located within the tumor suppressor region 3p21.3, and may play a role in the inhibition of tumor transformation and progression of several malignancies including lung cancer.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 70 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GFALFEKKGALAERQQLIPELVRNGDEENPLKRGLVAAYS GDSDNEEELVERLESEEEKLADWKKMACLLCRRQFPNK DALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPT KDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEA QVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME
Gene Name RBM5 RNA binding motif protein 5 [ Homo sapiens ]
Official Symbol RBM5
Synonyms RBM5; RNA binding motif protein 5; RNA-binding protein 5; H37; LUCA15;
Gene ID 10181
mRNA Refseq NM_005778
Protein Refseq NP_005769
MIM 606884
Uniprot ID P52756
Chromosome Location 3p21.3
Pathway Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Processing, organism-specific biosystem; mRNA Splicing, organism-specific biosystem;
Function DNA binding; RNA binding; mRNA binding; metal ion binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RBM5 Products

Required fields are marked with *

My Review for All RBM5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon