Recombinant Human RBM39 protein, GST-tagged

• Cat.No.: RBM39-246H
• Product Overview: Recombinant Human RBM39 (423 a.a. - 472 a.a.), fussed with GST tag at N-terminal, was expressed in Wheat Germ.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 31.24 kDa
• Protein length: 423 a.a. - 472 a.a.
• AA Sequence: TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
• Applications: Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: RBM39 RNA binding motif protein 39 [ Homo sapiens ]
• Official Symbol: RBM39
• Synonyms: RBM39; RNA binding motif protein 39; RNA binding region (RNP1, RRM) containing 2 , RNPC2; RNA-binding protein 39; CAPER; CC1.3; fSAP59; functional spliceosome associated protein 59; HCC1; splicing factor HCC1; hepatocellular carcinoma protein 1; RNA-binding region (RNP1, RRM) containing 2; functional spliceosome-associated protein 59; coactivator of activating protein-1 and estrogen receptors; RNPC2; FSAP59; CAPERalpha; FLJ44170; DKFZp781C0423
• Gene ID: 9584
• mRNA Refseq: NM_184234
• Protein Refseq: NP_909122
• MIM: 604739
• UniProt ID: Q14498
• Chromosome Location: 20q11.22
• Pathway: mRNA processing, organism-specific biosystem
• Function: RNA binding; nucleic acid binding; nucleotide binding; protein binding