Recombinant Human RBM18 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RBM18-4010H
Product Overview : RBM18 MS Standard C13 and N15-labeled recombinant protein (NP_149108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RBM18 (RNA Binding Motif Protein 18) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and nucleotide binding.
Molecular Mass : 21.5 kDa
AA Sequence : MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RBM18 RNA binding motif protein 18 [ Homo sapiens (human) ]
Official Symbol RBM18
Synonyms RBM18; RNA binding motif protein 18; probable RNA-binding protein 18; MGC2734; RNA-binding motif protein 18;
Gene ID 92400
mRNA Refseq NM_033117
Protein Refseq NP_149108
UniProt ID Q96H35

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RBM18 Products

Required fields are marked with *

My Review for All RBM18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon