Recombinant Human RBBP5, His-tagged

• Cat.No.: RBBP5-28182TH
• Product Overview: Recombinant fragment, corresponding to amino acids 359-538 of Human RbBP5 with an N terminal His tag. Predicted mwt: 20 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 359-538 a.a.
• Description: This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. The encoded protein binds directly to retinoblastoma protein, which regulates cell proliferation. It interacts preferentially with the underphosphorylated retinoblastoma protein via the E1A-binding pocket B. Three alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
• Conjugation: HIS
• Tissue specificity: Ubiquitously expressed.
• Form: Lyophilised:Reconstitute with 148 μl distilled water.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKA LLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEK KRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVK GDGKSKKKQAGRPKGSKGKEKDSPFKPKLYKGDRGLPLEG SAKGKVQAELSQPLTAGGAISELL
• Sequence Similarities: Contains 6 WD repeats.

Gene Information

• Gene Name: RBBP5 retinoblastoma binding protein 5 [ Homo sapiens ]
• Official Symbol: RBBP5
• Synonyms: RBBP5; retinoblastoma binding protein 5; retinoblastoma-binding protein 5; RBQ3; SWD1; Set1c WD40 repeat protein; homolog (S. cerevisiae)
• Gene ID: 5929
• mRNA Refseq: NM_001193272
• Protein Refseq: NP_001180201
• MIM: 600697
• Uniprot ID: Q15291
• Chromosome Location: 1q32
• Function: contributes_to histone methyltransferase activity (H3-K4 specific); methylated histone residue binding; protein binding; transcription regulatory region DNA binding