Recombinant Human RB1CC1 Protein (1241-1594 aa), His-Myc-tagged

Cat.No. : RB1CC1-2673H
Product Overview : Recombinant Human RB1CC1 Protein (1241-1594 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
ProteinLength : 1241-1594 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 47.7 kDa
AA Sequence : AIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name RB1CC1 RB1-inducible coiled-coil 1 [ Homo sapiens ]
Official Symbol RB1CC1
Synonyms RB1CC1; RB1-inducible coiled-coil 1; RB1-inducible coiled-coil protein 1; Cc1; DRAGOU14; FIP200; KIAA0203; CC1;
Gene ID 9821
mRNA Refseq NM_001083617
Protein Refseq NP_001077086
MIM 606837
UniProt ID Q8TDY2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RB1CC1 Products

Required fields are marked with *

My Review for All RB1CC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon