Recombinant Human RB1 protein, T7/His-tagged

• Cat.No.: RB1-173H
• Product Overview: Recombinant human RB1 pocket domain cDNA (372 -787 aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Form: 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKR VKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEV VMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSP LFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLK STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNID LKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: RB1 retinoblastoma 1 [ Homo sapiens ]
• Official Symbol: RB1
• Synonyms: RB1; retinoblastoma 1; OSRC, osteosarcoma; retinoblastoma-associated protein; RB; retinoblastoma suspectibility protein; pRb; OSRC; pp110; p105-Rb
• Gene ID: 5925
• mRNA Refseq: NM_000321
• Protein Refseq: NP_000312
• MIM: 614041
• UniProt ID: P06400
• Chromosome Location: 13q14.2
• Pathway: Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem
• Function: DNA binding; RNA polymerase II activating transcription factor binding; androgen receptor binding; core promoter binding; kinase activity; kinase binding; molecular_function; phosphoprotein binding; protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; transcription factor binding; ubiquitin protein ligase binding