Recombinant Human RASGRP1 protein, His-tagged

• Cat.No.: RASGRP1-2922H
• Product Overview: Recombinant Human RASGRP1 protein(678-797 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 678-797 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: QPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RASGRP1 RAS guanyl releasing protein 1 (calcium and DAG-regulated) [ Homo sapiens ]
• Official Symbol: RASGRP1
• Synonyms: RASGRP1; RAS guanyl releasing protein 1 (calcium and DAG-regulated); RAS guanyl-releasing protein 1; CalDAG GEFII; RASGRP; ras activator RasGRP; RAS guanyl nucleotide-releasing protein 1; calcium and DAG-regulated guanine nucleotide exchange factor II; guanine nucleotide exchange factor, calcium- and DAG-regulated, Rap1A; V; hRasGRP1; CALDAG-GEFI; CALDAG-GEFII; MGC129998; MGC129999
• Gene ID: 10125
• mRNA Refseq: NM_001128602
• Protein Refseq: NP_001122074
• MIM: 603962
• UniProt ID: O95267