Recombinant Human RARRES2 Protein

Cat.No. : RARRES2-233H
Product Overview : Recombinant Human RARRES2 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Chemerin is a chemoattractant adipokine that is expressed in white adipose, liver, skin, and lung tissues. Chemerin is a ligand for the G protein-coupled receptor chemokine-like receptor 1 (ChemR23), which is expressed on dendritic cells, macrophages, and adipocytes. Chemerin functions to recruit macrophages to sites of tissue damage and inflammation. Chemerin is also a regulator of glucose metabolism in the liver. Due to the roles of chemerin during metabolism and inflammation, it may be a key factor in obesity-related diseases such as type 2 diabetes mellitus.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 16 kDa (138 aa)
AA Sequence : MELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name RARRES2 retinoic acid receptor responder (tazarotene induced) 2 [ Homo sapiens (human) ]
Official Symbol RARRES2
Synonyms RARRES2; retinoic acid receptor responder (tazarotene induced) 2; retinoic acid receptor responder protein 2; chemerin; HP10433; TIG2; RAR-responsive protein TIG2; tazarotene-induced gene 2 protein;
Gene ID 5919
mRNA Refseq NM_002889
Protein Refseq NP_002880
MIM 601973
UniProt ID Q99969

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RARRES2 Products

Required fields are marked with *

My Review for All RARRES2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon