Recombinant Human RARRES2 Protein

• Cat.No.: RARRES2-233H
• Product Overview: Recombinant Human RARRES2 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Chemerin is a chemoattractant adipokine that is expressed in white adipose, liver, skin, and lung tissues. Chemerin is a ligand for the G protein-coupled receptor chemokine-like receptor 1 (ChemR23), which is expressed on dendritic cells, macrophages, and adipocytes. Chemerin functions to recruit macrophages to sites of tissue damage and inflammation. Chemerin is also a regulator of glucose metabolism in the liver. Due to the roles of chemerin during metabolism and inflammation, it may be a key factor in obesity-related diseases such as type 2 diabetes mellitus.
• Bio-activity: No biological activity data is available at this time.
• Molecular Mass: Monomer, 16 kDa (138 aa)
• AA Sequence: MELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: RARRES2 retinoic acid receptor responder (tazarotene induced) 2 [ Homo sapiens (human) ]
• Official Symbol: RARRES2
• Synonyms: RARRES2; retinoic acid receptor responder (tazarotene induced) 2; retinoic acid receptor responder protein 2; chemerin; HP10433; TIG2; RAR-responsive protein TIG2; tazarotene-induced gene 2 protein
• Gene ID: 5919
• mRNA Refseq: NM_002889
• Protein Refseq: NP_002880
• MIM: 601973
• UniProt ID: Q99969