Recombinant Human RARRES1

• Cat.No.: RARRES1-31293TH
• Product Overview: Recombinant fragment of Human RARRES1 with N terminal proprietary tag, 35.53kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 90 amino acids
• Description: This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed.
• Molecular Weight: 35.530kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
• Sequence Similarities: Belongs to the protease inhibitor I47 (latexin) family.

Gene Information

• Gene Name: RARRES1 retinoic acid receptor responder (tazarotene induced) 1 [ Homo sapiens ]
• Official Symbol: RARRES1
• Synonyms: RARRES1; retinoic acid receptor responder (tazarotene induced) 1; retinoic acid receptor responder protein 1; TIG1
• Gene ID: 5918
• mRNA Refseq: NM_002888
• Protein Refseq: NP_002879
• MIM: 605090
• Uniprot ID: P49788
• Chromosome Location: 3q25.32