Recombinant Human RARRES1
Cat.No. : | RARRES1-31293TH |
Product Overview : | Recombinant fragment of Human RARRES1 with N terminal proprietary tag, 35.53kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed. |
Molecular Weight : | 35.530kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF |
Sequence Similarities : | Belongs to the protease inhibitor I47 (latexin) family. |
Gene Name | RARRES1 retinoic acid receptor responder (tazarotene induced) 1 [ Homo sapiens ] |
Official Symbol | RARRES1 |
Synonyms | RARRES1; retinoic acid receptor responder (tazarotene induced) 1; retinoic acid receptor responder protein 1; TIG1; |
Gene ID | 5918 |
mRNA Refseq | NM_002888 |
Protein Refseq | NP_002879 |
MIM | 605090 |
Uniprot ID | P49788 |
Chromosome Location | 3q25.32 |
◆ Recombinant Proteins | ||
RARRES1-432HF | Recombinant Full Length Human RARRES1 Protein | +Inquiry |
RFL7475HF | Recombinant Full Length Human Retinoic Acid Receptor Responder Protein 1(Rarres1) Protein, His-Tagged | +Inquiry |
RARRES1-6103C | Recombinant Chicken RARRES1 | +Inquiry |
RARRES1-204H | Recombinant Human RARRES1 protein, His-tagged | +Inquiry |
RARRES1-31293TH | Recombinant Human RARRES1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RARRES1-1470HCL | Recombinant Human RARRES1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RARRES1 Products
Required fields are marked with *
My Review for All RARRES1 Products
Required fields are marked with *
0
Inquiry Basket