Recombinant Human RAP2A, His-tagged

• Cat.No.: RAP2A-30504TH
• Product Overview: Recombinant full length Human Rap2A with an N terminal His tag; 200 amino acids with tag, Predicted MWt 22.4 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 180 amino acids
• Description: Ribokinase, also known as RBKS, belongs to the pfkB family of carbohydrate kinases. It phosphorylates ribose to form ribose-5-phosphate in the presence of ATP and magnesium as a first step in ribose metabolism.
• Conjugation: HIS
• Molecular Weight: 22.400kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSAC

Gene Information

• Gene Name: RAP2A RAP2A, member of RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAP2A
• Synonyms: RAP2A; RAP2A, member of RAS oncogene family; RAP2; ras-related protein Rap-2a; K REV
• Gene ID: 5911
• mRNA Refseq: NM_021033
• Protein Refseq: NP_066361
• MIM: 179540
• Uniprot ID: P10114
• Chromosome Location: 13q34
• Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem
• Function: GTP binding; GTPase activity; nucleotide binding; protein binding