Recombinant Human RANBP1
Cat.No. : | RANBP1-30900TH |
Product Overview : | Recombinant full length Human RanBP1 protein with an N terminal proprietary tag; predicted mwt: 49.11 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 210 amino acids |
Description : | Ran/TC4-binding protein, RanBP1, interacts specifically with GTP-charged RAN. RANBP1 encodes a 23-kD protein that binds to RAN complexed with GTP but not GDP. RANBP1 does not activate GTPase activity of RAN but does markedly increase GTP hydrolysis by the RanGTPase-activating protein (RanGAP1). The RANBP1 cDNA encodes a 201-amino acid protein that is 92% similar to its mouse homolog. In both mammalian cells and in yeast, RANBP1 acts as a negative regulator of RCC1 by inhibiting RCC1-stimulated guanine nucleotide release from RAN. |
Molecular Weight : | 49.110kDa |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKT LEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKH KEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRK EIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEK Q |
Sequence Similarities : | Belongs to the RANBP1 family.Contains 1 RanBD1 domain. |
Gene Name | RANBP1 RAN binding protein 1 [ Homo sapiens ] |
Official Symbol | RANBP1 |
Synonyms | RANBP1; RAN binding protein 1; ran-specific GTPase-activating protein; HTF9A; |
Gene ID | 5902 |
mRNA Refseq | NM_002882 |
Protein Refseq | NP_002873 |
MIM | 601180 |
Uniprot ID | P43487 |
Chromosome Location | 22q11.21 |
Pathway | E2F transcription factor network, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function | GDP-dissociation inhibitor activity; GTPase activator activity; Ran GTPase binding; |
◆ Recombinant Proteins | ||
RANBP1-3781R | Recombinant Rhesus monkey RANBP1 Protein, His-tagged | +Inquiry |
RANBP1-12035Z | Recombinant Zebrafish RANBP1 | +Inquiry |
RANBP1-426HF | Recombinant Full Length Human RANBP1 Protein | +Inquiry |
RANBP1-30900TH | Recombinant Human RANBP1 | +Inquiry |
RANBP1-1332C | Recombinant Chicken RANBP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RANBP1-2534HCL | Recombinant Human RANBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RANBP1 Products
Required fields are marked with *
My Review for All RANBP1 Products
Required fields are marked with *
0
Inquiry Basket