Recombinant Human RALGPS1 Protein (1-305 aa), His-SUMO-tagged

• Cat.No.: RALGPS1-1025H
• Product Overview: Recombinant Human RALGPS1 Protein (1-305 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Isoform 4.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-305 aa
• Description: Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization . Guanine nucleotide exchange factor for.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 50.7 kDa
• AA Sequence: MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: RALGPS1 Ral GEF with PH domain and SH3 binding motif 1 [ Homo sapiens ]
• Official Symbol: RALGPS1
• Synonyms: RALGPS1; KIAA0351; RALGEF2; RALGPS1A; RalGEF 2; RP13-225O21.1
• Gene ID: 9649
• mRNA Refseq: NM_001190728
• Protein Refseq: NP_001177657
• MIM: 614444
• UniProt ID: Q5JS13