Recombinant Human RAET1E protein, His-tagged
Cat.No. : | RAET1E-2937H |
Product Overview : | Recombinant Human RAET1E protein(95-190 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 95-190 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | GEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQHEAERCTGASWQFTINGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCD |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | RAET1E retinoic acid early transcript 1E [ Homo sapiens ] |
Official Symbol | RAET1E |
Synonyms | RAET1E; retinoic acid early transcript 1E; NKG2D ligand 4; bA350J20.7; LETAL; ULBP4; RAE-1-like transcript 4; lymphocyte effector toxicity activation ligand; RL-4; N2DL-4; NKG2DL4; RAET1E2; MGC125308; MGC125309; |
mRNA Refseq | NM_001243325 |
Protein Refseq | NP_001230254 |
MIM | 609243 |
UniProt ID | Q8TD07 |
Gene ID | 135250 |
◆ Recombinant Proteins | ||
RAET1E-381H | Recombinant Human retinoic acid early transcript 1E, His-tagged | +Inquiry |
RAET1E-206H | Recombinant Human RAET1E Protein, His-tagged | +Inquiry |
RAET1E-1387H | Recombinant Human RAET1E protein, hFc-tagged | +Inquiry |
Raet1e-02M | Recombinant Mouse Raet1e Protein, His tagged | +Inquiry |
RAET1E-765H | Recombinant Human RAET1E Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAET1E-2549HCL | Recombinant Human RAET1E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAET1E Products
Required fields are marked with *
My Review for All RAET1E Products
Required fields are marked with *
0
Inquiry Basket