Recombinant Human RAE1 protein, GST-tagged

• Cat.No.: RAE1-3408H
• Product Overview: Recombinant Human RAE1 protein(P78406)(1-368aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-368aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 68 kDa
• AA Sequence: MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RAE1 RAE1 RNA export 1 homolog (S. pombe) [ Homo sapiens ]
• Official Symbol: RAE1
• Synonyms: RAE1; RAE1 RNA export 1 homolog (S. pombe); RAE1 (RNA export 1, S.pombe) homolog; mRNA export factor; Mnrp41; mRNA export protein; rae1 protein homolog; migration-inducing gene 14; mRNA-binding protein, 41-kD; mRNA-associated protein MRNP 41; homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer); MIG14; MRNP41; dJ481F12.3; dJ800J21.1; FLJ30608; MGC117333; MGC126076; MGC126077
• Gene ID: 8480
• mRNA Refseq: NM_001015885
• Protein Refseq: NP_001015885
• MIM: 603343
• UniProt ID: P78406