Recombinant Human RAD52 protein, GST-tagged

• Cat.No.: RAD52-301602H
• Product Overview: Recombinant Human RAD52 (234-418 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met234-Ser418
• AA Sequence: MADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RAD52 RAD52 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: RAD52
• Synonyms: RAD52; RAD52 homolog (S. cerevisiae); RAD52 (S. cerevisiae) homolog; DNA repair protein RAD52 homolog; recombination protein RAD52; rhabdomyosarcoma antigen MU-RMS-40.23
• Gene ID: 5893
• mRNA Refseq: NM_134424
• Protein Refseq: NP_602296
• MIM: 600392
• UniProt ID: P43351