Recombinant Human RAC3

• Cat.No.: RAC3-31284TH
• Product Overview: Recombinant full length Human RAC3 ; 189 amino acids, Predicted MWt 21 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 189 amino acids
• Description: The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases.
• Molecular Weight: 21.000kDa
• Tissue specificity: Highest levels in brain, also detected in heart, placenta and pancreas.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 2mM DTT, 1mM EDTA, 0.1mM PMSF, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC
• Sequence Similarities: Belongs to the small GTPase superfamily. Rho family.

Gene Information

• Gene Name: RAC3 ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) [ Homo sapiens ]
• Official Symbol: RAC3
• Synonyms: RAC3; ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3); ras-related C3 botulinum toxin substrate 3
• Gene ID: 5881
• mRNA Refseq: NM_005052
• Protein Refseq: NP_005043
• MIM: 602050
• Uniprot ID: P60763
• Chromosome Location: 17q25.3
• Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem
• Function: GTP binding; GTPase activity; nucleotide binding; protein binding