Recombinant Full Length Human RAC3 protein, GST-tagged

• Cat.No.: RAC3-3406H
• Product Overview: Recombinant Human RAC3 protein(P60763)(1-192aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48 kDa
• Protein length: 1-192 a.a.
• AA Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RAC3 ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) [ Homo sapiens ]
• Official Symbol: RAC3
• Synonyms: RAC3; ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3); ras-related C3 botulinum toxin substrate 3; p21-Rac3; rho family, small GTP binding protein Rac3
• Gene ID: 5881
• mRNA Refseq: NM_005052
• Protein Refseq: NP_005043
• MIM: 602050
• UniProt ID: P60763