Recombinant Human RABL5 protein, His-tagged

• Cat.No.: RABL5-2955H
• Product Overview: Recombinant Human RABL5 protein(1 - 108 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1 - 108 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RABL5 RAB, member RAS oncogene family-like 5 [ Homo sapiens ]
• Official Symbol: RABL5
• Synonyms: RABL5; RAB, member RAS oncogene family-like 5; rab-like protein 5; DKFZp761N0823; FLJ13225; FLJ14117; RAB, member of RAS oncogene family-like 5
• Gene ID: 64792
• mRNA Refseq: NM_001130820
• Protein Refseq: NP_001124292
• UniProt ID: Q9H7X7