Recombinant Human RABL4 protein, His-tagged

• Cat.No.: RABL4-2146H
• Product Overview: Recombinant Human RABL4 (1-186aa) fussed with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-186aa
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
• Molecular Mass: 26 kDa
• AA Sequence: MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEML DKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECF ETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
• Stability: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: IFT27 intraflagellar transport 27 homolog (Chlamydomonas) [ Homo sapiens ]
• Official Symbol: IFT27
• Synonyms: IFT27; intraflagellar transport 27 homolog (Chlamydomonas); RAB, member of RAS oncogene family like 4 , RABL4; intraflagellar transport protein 27 homolog; RAYL; rab-like protein 4; RAB, member of RAS oncogene family-like 4; RABL4; FLJ33389; DKFZp686M22208
• Gene ID: 11020
• mRNA Refseq: NM_001177701
• Protein Refseq: NP_001171172
• MIM: 615870
• UniProt ID: Q9BW83
• Chromosome Location: 22q13.1
• Function: GTP binding; nucleotide binding