Recombinant Human RAB39B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB39B-4261H
• Product Overview: RAB39B MS Standard C13 and N15-labeled recombinant protein (NP_741995) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking. Mutations in this gene are associated with X-linked cognitive disability.
• Molecular Mass: 24.6 kDa
• AA Sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB39B RAB39B, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB39B
• Synonyms: RAB39B; RAB39B, member RAS oncogene family; ras-related protein Rab-39B; MRX72
• Gene ID: 116442
• mRNA Refseq: NM_171998
• Protein Refseq: NP_741995
• MIM: 300774
• UniProt ID: Q96DA2