Recombinant Human RAB35 protein(1-201aa), His-GST-tagged

• Cat.No.: RAB35-2146H
• Product Overview: Recombinant Human RAB35 protein(Q15286)(1-201aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 1-201aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.6 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC

Gene Information

• Gene Name: RAB35 RAB35, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB35
• Synonyms: RAB35; RAB35, member RAS oncogene family; ras-related protein Rab-35; H ray; GTP-binding protein RAY; ras-related protein rab-1c (GTP-binding protein ray); RAY; H-ray; RAB1C
• Gene ID: 11021
• mRNA Refseq: NM_001167606
• Protein Refseq: NP_001161078
• MIM: 604199
• UniProt ID: Q15286