Recombinant Full Length Human RAB35 Protein, His-tagged

• Cat.No.: RAB35-29052TH
• Product Overview: Recombinant full length Human RAB35 with an N terminal His tag; 221 amino acids with tag, Predicted MWt 25.2 kDa.

Specification

• Protein length: 1-201 a.a.
• Conjugation: HIS
• Molecular Weight: 25.200kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
• Sequence Similarities: Belongs to the small GTPase superfamily. Rab family.

Gene Information

• Gene Name: RAB35 RAB35, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB35
• Synonyms: RAB35; RAB35, member RAS oncogene family; ras-related protein Rab-35; H ray
• Gene ID: 11021
• mRNA Refseq: NM_001167606
• Protein Refseq: NP_001161078
• MIM: 604199
• Uniprot ID: Q15286
• Chromosome Location: 12q24
• Function: GTP binding; GTPase activity; nucleotide binding; phosphatidylinositol-4,5-bisphosphate binding