Recombinant Full Length Human RAB35 Protein, His-tagged
Cat.No. : | RAB35-29052TH |
Product Overview : | Recombinant full length Human RAB35 with an N terminal His tag; 221 amino acids with tag, Predicted MWt 25.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-201 a.a. |
Conjugation : | HIS |
Molecular Weight : | 25.200kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC |
Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
Gene Name | RAB35 RAB35, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB35 |
Synonyms | RAB35; RAB35, member RAS oncogene family; ras-related protein Rab-35; H ray; |
Gene ID | 11021 |
mRNA Refseq | NM_001167606 |
Protein Refseq | NP_001161078 |
MIM | 604199 |
Uniprot ID | Q15286 |
Chromosome Location | 12q24 |
Function | GTP binding; GTPase activity; nucleotide binding; phosphatidylinositol-4,5-bisphosphate binding; |
◆ Recombinant Proteins | ||
RAB35-2146H | Recombinant Human RAB35 protein(1-201aa), His-GST-tagged | +Inquiry |
RAB35-1832H | Recombinant Human RAB35 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB35-1648HFL | Recombinant Full Length Human RAB35 Protein, C-Flag-tagged | +Inquiry |
RAB35-2116H | Recombinant Full Length Human RAB35 Protein, GST-tagged | +Inquiry |
RAB35-4888R | Recombinant Rat RAB35 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB35-2604HCL | Recombinant Human RAB35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB35 Products
Required fields are marked with *
My Review for All RAB35 Products
Required fields are marked with *
0
Inquiry Basket