Recombinant Full Length Human RAB35 Protein, His-tagged

Cat.No. : RAB35-29052TH
Product Overview : Recombinant full length Human RAB35 with an N terminal His tag; 221 amino acids with tag, Predicted MWt 25.2 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-201 a.a.
Conjugation : HIS
Molecular Weight : 25.200kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
Sequence Similarities : Belongs to the small GTPase superfamily. Rab family.
Gene Name RAB35 RAB35, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB35
Synonyms RAB35; RAB35, member RAS oncogene family; ras-related protein Rab-35; H ray;
Gene ID 11021
mRNA Refseq NM_001167606
Protein Refseq NP_001161078
MIM 604199
Uniprot ID Q15286
Chromosome Location 12q24
Function GTP binding; GTPase activity; nucleotide binding; phosphatidylinositol-4,5-bisphosphate binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RAB35 Products

Required fields are marked with *

My Review for All RAB35 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon