Recombinant Human RAB34 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB34-891H
Product Overview : RAB34 MS Standard C13 and N15-labeled recombinant protein (NP_114140) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein belonging to the RAB family of proteins, which are small GTPases involved in protein transport. This family member is a Golgi-bound member of the secretory pathway that is involved in the repositioning of lysosomes and the activation of macropinocytosis. Alternative splicing of this gene results in multiple transcript variants. An alternatively spliced transcript variant produces the nine-amino acid residue-repeats (NARR) protein, which is a functionally distinct nucleolar protein resulting from a different reading frame.
Molecular Mass : 29.1 kDa
AA Sequence : MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDNNLYLTASKKKPTCCPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB34 RAB34, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB34
Synonyms RAB34; RAB34, member RAS oncogene family; ras-related protein Rab-34; RAB39; RAH; ras-related protein Rah; ras-related protein Rab-39;
Gene ID 83871
mRNA Refseq NM_031934
Protein Refseq NP_114140
MIM 610917
UniProt ID P0DI83

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RAB34 Products

Required fields are marked with *

My Review for All RAB34 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon