Recombinant Human RAB34 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB34-891H
• Product Overview: RAB34 MS Standard C13 and N15-labeled recombinant protein (NP_114140) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a protein belonging to the RAB family of proteins, which are small GTPases involved in protein transport. This family member is a Golgi-bound member of the secretory pathway that is involved in the repositioning of lysosomes and the activation of macropinocytosis. Alternative splicing of this gene results in multiple transcript variants. An alternatively spliced transcript variant produces the nine-amino acid residue-repeats (NARR) protein, which is a functionally distinct nucleolar protein resulting from a different reading frame.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 29.1 kDa
• AA Sequence: MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDNNLYLTASKKKPTCCPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB34 RAB34, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB34
• Synonyms: RAB34; RAB34, member RAS oncogene family; ras-related protein Rab-34; RAB39; RAH; ras-related protein Rah; ras-related protein Rab-39
• Gene ID: 83871
• mRNA Refseq: NM_031934
• Protein Refseq: NP_114140
• MIM: 610917
• UniProt ID: P0DI83