Recombinant Human RAB33A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB33A-3514H
Product Overview : RAB33A MS Standard C13 and N15-labeled recombinant protein (NP_004785) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It is GTP-binding protein and may be involved in vesicle transport.
Molecular Mass : 26.6 kDa
AA Sequence : MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB33A RAB33A, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB33A
Synonyms RAB33A; RAB33A, member RAS oncogene family; ras-related protein Rab-33A; RabS10; Small GTP-binding protein S10; MGC1488;
Gene ID 9363
mRNA Refseq NM_004794
Protein Refseq NP_004785
MIM 300333
UniProt ID Q14088

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RAB33A Products

Required fields are marked with *

My Review for All RAB33A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon