Recombinant Human RAB31 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB31-4518H
Product Overview : RAB31 MS Standard C13 and N15-labeled recombinant protein (NP_006859) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Small GTP-binding proteins of the RAB family, such as RAB31, play essential roles in vesicle and granule targeting.
Molecular Mass : 21.7 kDa
AA Sequence : MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB31 RAB31, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB31
Synonyms RAB31; RAB31, member RAS oncogene family; ras-related protein Rab-31; Rab22B; ras-related protein Rab-22B;
Gene ID 11031
mRNA Refseq NM_006868
Protein Refseq NP_006859
MIM 605694
UniProt ID Q13636

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RAB31 Products

Required fields are marked with *

My Review for All RAB31 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon