Recombinant Human RAB31 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB31-4518H
• Product Overview: RAB31 MS Standard C13 and N15-labeled recombinant protein (NP_006859) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Small GTP-binding proteins of the RAB family, such as RAB31, play essential roles in vesicle and granule targeting.
• Molecular Mass: 21.7 kDa
• AA Sequence: MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB31 RAB31, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB31
• Synonyms: RAB31; RAB31, member RAS oncogene family; ras-related protein Rab-31; Rab22B; ras-related protein Rab-22B
• Gene ID: 11031
• mRNA Refseq: NM_006868
• Protein Refseq: NP_006859
• MIM: 605694
• UniProt ID: Q13636