Recombinant Human RAB27A protein, GST-tagged

• Cat.No.: RAB27A-334H
• Product Overview: Recombinant Human RAB27A protein(NP_004571)(1-221 aa), GST-tagged

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-221 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).

Gene Information

• Gene Name: RAB27A RAB27A, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB27A
• Synonyms: RAB27A; RAB27A, member RAS oncogene family; ras-related protein Rab-27A; GS2; HsT18676; RAB27; RAM; rab-27; GTP-binding protein Ram; MGC117246
• Gene ID: 5873
• mRNA Refseq: NM_004580
• Protein Refseq: NP_004571
• MIM: 603868
• UniProt ID: P51159