Recombinant Human RAB24 protein, T7/His-tagged

Cat.No. : RAB24-166H
Product Overview : Recombinant human Rab24 cDNA ( 202 aa, derived from BC015534 ) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVA KVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKS DLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYF YSCCHH
Purity : >90% by SDS-PAGE
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name RAB24 RAB24, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB24
Synonyms RAB24; RAB24, member RAS oncogene family; ras-related protein Rab-24;
Gene ID 53917
mRNA Refseq NM_001031677
Protein Refseq NP_001026847
MIM 612415
UniProt ID Q969Q5
Chromosome Location 5q35.3
Function GTP binding; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RAB24 Products

Required fields are marked with *

My Review for All RAB24 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon