Recombinant Human RAB24, His-tagged

• Cat.No.: RAB24-31280TH
• Product Overview: Recombinant full-length Human Rab24 with a N terminal His tag; 227 amino acids with a predicted MWt 25.7 kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 227 amino acids
• Description: RAB24 is a small GTPase of the Rab subfamily of Ras-related proteins that regulate intracellular protein trafficking (Olkkonen et al.
• Conjugation: HIS
• Molecular Weight: 25.700kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.03% EDTA
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH
• Sequence Similarities: Belongs to the small GTPase superfamily. Rab family.

Gene Information

• Gene Name: RAB24 RAB24, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB24
• Synonyms: RAB24; RAB24, member RAS oncogene family; ras-related protein Rab-24
• Gene ID: 53917
• mRNA Refseq: NM_001031677
• Protein Refseq: NP_001026847
• MIM: 612415
• Uniprot ID: Q969Q5
• Chromosome Location: 5q35.3
• Function: GTP binding; nucleotide binding; protein binding