Recombinant Human RAB21 protein, T7/His-tagged
Cat.No. : | RAB21-204H |
Product Overview : | Recombinant human Rab21 cDNA (224 aa, derived from BC092475) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDK HITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLG NEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQ PGTARRGVQIIDDEPQAQTSGGGCCSSG |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | RAB21 RAB21, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB21 |
Synonyms | RAB21; RAB21, member RAS oncogene family; ras-related protein Rab-21; KIAA0118; |
Gene ID | 23011 |
mRNA Refseq | NM_014999 |
Protein Refseq | NP_055814 |
MIM | 612398 |
UniProt ID | Q9UL25 |
Chromosome Location | 12q15 |
Function | GDP binding; GTP binding; GTPase activity; nucleotide binding; protein binding; |
◆ Native Proteins | ||
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
F10-63H | Native Human Factor X | +Inquiry |
Collagen-62B | Native Bovine Collagen Type XI | +Inquiry |
◆ Cell & Tissue Lysates | ||
Lung-434S | Sheep Lung Lysate, Total Protein | +Inquiry |
BAX-8506HCL | Recombinant Human BAX 293 Cell Lysate | +Inquiry |
TF-001RCL | Recombinant Rat TF cell lysate | +Inquiry |
NLRP4-3798HCL | Recombinant Human NLRP4 293 Cell Lysate | +Inquiry |
PDIA3-3331HCL | Recombinant Human PDIA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB21 Products
Required fields are marked with *
My Review for All RAB21 Products
Required fields are marked with *
0
Inquiry Basket