Recombinant Human RAB21 protein, T7/His-tagged

Cat.No. : RAB21-204H
Product Overview : Recombinant human Rab21 cDNA (224 aa, derived from BC092475) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDK HITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLG NEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQ PGTARRGVQIIDDEPQAQTSGGGCCSSG
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name RAB21 RAB21, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB21
Synonyms RAB21; RAB21, member RAS oncogene family; ras-related protein Rab-21; KIAA0118;
Gene ID 23011
mRNA Refseq NM_014999
Protein Refseq NP_055814
MIM 612398
UniProt ID Q9UL25
Chromosome Location 12q15
Function GDP binding; GTP binding; GTPase activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RAB21 Products

Required fields are marked with *

My Review for All RAB21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon