Recombinant Human RAB14 protein, T7-tagged

• Cat.No.: RAB14-216H
• Product Overview: Recombinant human RAB14 (215aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKI KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVT YEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR EGCGC
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
• Protein length: 215 a.a.

Gene Information

• Gene Name: RAB14 RAB14, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB14
• Synonyms: RAB14; RAB14, member RAS oncogene family; ras-related protein Rab-14; bA165P4.3 (member RAS oncogene family); F protein binding protein 1; FBP; RAB 14;RAB-14
• Gene ID: 51552
• mRNA Refseq: NM_016322
• Protein Refseq: NP_057406
• MIM: 612673
• UniProt ID: P61106
• Chromosome Location: 9q32-q34.11
• Function: GDP binding; GTP binding; GTPase activity; GTPase activity; glycoprotein binding; nucleotide binding; protein binding