Recombinant Human RAB14 protein, T7-tagged

Cat.No. : RAB14-216H
Product Overview : Recombinant human RAB14 (215aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 215 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKI KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVT YEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR EGCGC
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name RAB14 RAB14, member RAS oncogene family [ Homo sapiens ]
Official Symbol RAB14
Synonyms RAB14; RAB14, member RAS oncogene family; ras-related protein Rab-14; bA165P4.3 (member RAS oncogene family); F protein binding protein 1; FBP; RAB 14;RAB-14;
Gene ID 51552
mRNA Refseq NM_016322
Protein Refseq NP_057406
MIM 612673
UniProt ID P61106
Chromosome Location 9q32-q34.11
Function GDP binding; GTP binding; GTPase activity; GTPase activity; glycoprotein binding; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RAB14 Products

Required fields are marked with *

My Review for All RAB14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon