Recombinant Human QPCT Protein, His-SUMO-tagged

• Cat.No.: QPCT-1347H
• Product Overview: Recombinant Human QPCT Protein (29-361aa) was expressed in E. coli with N-terminal His tag.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 53.9 kDa
• AA Sequence: VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 29-361 a.a.

Gene Information

• Gene Name: QPCT glutaminyl-peptide cyclotransferase [ Homo sapiens ]
• Official Symbol: QPCT
• Synonyms: QPCT; glutaminyl-peptide cyclotransferase; GCT; glutaminyl cyclase; QC; EC; glutamyl cyclase; glutaminyl-tRNA cyclotransferase; sQC
• Gene ID: 25797
• mRNA Refseq: NM_012413
• Protein Refseq: NP_036545
• MIM: 607065
• UniProt ID: Q16769