Recombinant Human PVRIG protein, GST-tagged

• Cat.No.: PVRIG-32H
• Product Overview: Recombinant Human PVRIG(38 a.a. - 326 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: PVRIG played an important role in many functions.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 57.53 kDa
• AA Sequence: TAGTPEVWVQVRMEATELSSFTIRCGFLGSGSISLVTVSWGGPDGAGGTTLAVLHPERGIRQWAPARQARWETQS SISLILEGSGASSPCANTTFCCKFASFPEGSWEACGSLPPSSDPGLSAPPTPAPILRADLAGILGVSGVLLFGCV YLLHLLRRHKHRPAPRLQPSRTSPQAPRARAWAPSQASQAALHVPYATINTSCRPATLDTAHPHGGPSWWAPLPT HAAHRPQGPAAWASTPIPARGSFVSVENGLYAQAGERPPHTGPGLTLFPDPRGPRAMEGPLGVR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 38-326 a.a.

Gene Information

• Gene Name: PVRIG poliovirus receptor related immunoglobulin domain containing [ Homo sapiens ]
• Official Symbol: PVRIG
• Synonyms: PVRIG; poliovirus receptor related immunoglobulin domain containing; transmembrane protein PVRIG; C7orf15; MGC2463; poliovirus receptor-related immunoglobulin domain-containing protein; MGC104322; MGC138295; MGC138297
• Gene ID: 79037
• mRNA Refseq: NM_024070
• Protein Refseq: NP_076975
• UniProt ID: Q6DKI7
• Chromosome Location: 7q22