Recombinant Human PVALB, His-tagged

• Cat.No.: PVALB-29530TH
• Product Overview: Recombinant full length Human Parvalbumin with an N terminal His tag; 134 amino acids with tag, MWt 14.6kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 110 amino acids
• Description: The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation.
• Conjugation: HIS
• Molecular Weight: 14.600kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
• Sequence Similarities: Belongs to the parvalbumin family.Contains 2 EF-hand domains.

Gene Information

• Gene Name: PVALB parvalbumin [ Homo sapiens ]
• Official Symbol: PVALB
• Synonyms: PVALB; parvalbumin; parvalbumin alpha; D22S749
• Gene ID: 5816
• mRNA Refseq: NM_002854
• Protein Refseq: NP_002845
• MIM: 168890
• Uniprot ID: P20472
• Chromosome Location: 22q13.1
• Function: calcium ion binding