Recombinant Human PUSL1 protein, GST-tagged

• Cat.No.: PUSL1-315H
• Product Overview: Recombinant Human PUSL1(1 a.a. - 303 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-303 a.a.
• Description: Pseudouridylate synthase-like played an important role in many functions.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 59.6 kDa
• AA Sequence: MSSAPASGSVRARYLVYFQYVGTDFNGVAAVRGTQRAVGVQNYLEEAAERLNSVEPVRFTISSRTDAGVHALSNA AHLDVQRRSGRPPFPPEVLAEALNTHLRHPAIRVLRAFRVPSDFHARHAATSRTYLYRLATGCHRRDELPVFERN LCWTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFE SQSFLYRQVRRMTAVLVAVGLGALAPAQVKTILESQDPLGKHQTRVAPAHGLFLKSVLYGNLGAASCTLQGPQFG SHG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PUSL1 pseudouridylate synthase-like 1 [ Homo sapiens ]
• Official Symbol: PUSL1
• Synonyms: PUSL1; pseudouridylate synthase-like 1; tRNA pseudouridine synthase-like 1; FLJ90811; tRNA-uridine isomerase-like 1; tRNA pseudouridylate synthase-like 1
• Gene ID: 126789
• mRNA Refseq: NM_153339
• Protein Refseq: NP_699170
• UniProt ID: Q8N0Z8
• Chromosome Location: 1p36.33
• Function: RNA binding; isomerase activity; pseudouridine synthase activity