Recombinant Human PTS Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PTS-5376H
Product Overview : PTS MS Standard C13 and N15-labeled recombinant protein (NP_000308) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The enzyme encoded by this gene catalyzes the elimination of inorganic triphosphate from dihydroneopterin triphosphate, which is the second and irreversible step in the biosynthesis of tetrahydrobiopterin from GTP. Tetrahydrobiopterin, also known as BH(4), is an essential cofactor and regulator of various enzyme activities, including enzymes involved in serotonin biosynthesis and NO synthase activity. Mutations in this gene result in hyperphenylalaninemia.
Molecular Mass : 16.4 kDa
AA Sequence : MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYMWDNLQKVLPVGVLYKVKVYETDNNIVVYKGETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PTS 6-pyruvoyltetrahydropterin synthase [ Homo sapiens (human) ]
Official Symbol PTS
Synonyms PTS; PTPS; 6-pyruvoyltetrahydropterin synthase; 6-pyruvoyl tetrahydrobiopterin synthase; PTP synthase; EC 4.2.3.12
Gene ID 5805
mRNA Refseq NM_000317
Protein Refseq NP_000308
MIM 612719
UniProt ID Q03393

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PTS Products

Required fields are marked with *

My Review for All PTS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon