Recombinant Human PTPRN Protein, His-tagged
Cat.No. : | PTPRN-677H |
Product Overview : | Recombinant Human PTPRN, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-255 a.a. |
Description : | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. Alternate splicing results in multiple transcript variants. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH8.0 |
Molecular Mass : | 44.6kD |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMRQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVN |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | PTPRN protein tyrosine phosphatase, receptor type, N [ Homo sapiens ] |
Official Symbol | PTPRN |
Synonyms | PTPRN; protein tyrosine phosphatase, receptor type, N; receptor-type tyrosine-protein phosphatase-like N; IA 2; ICA 512; PTP IA-2; islet cell antigen 2; islet cell antigen 512; islet cell autoantigen 3; protein tyrosine phosphatase-like N; IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; FLJ16131; |
Gene ID | 5798 |
mRNA Refseq | NM_001199763 |
Protein Refseq | NP_001186692 |
MIM | 601773 |
UniProt ID | Q16849 |
◆ Recombinant Proteins | ||
PTPRN-0047H | Recombinant Human PTPRN Protein | +Inquiry |
PTPRN-677H | Recombinant Human PTPRN Protein, His-tagged | +Inquiry |
PTPRN-676H | Recombinant Human PTPRN Protein, His-tagged | +Inquiry |
PTPRN-6110H | Recombinant Human PTPRN Protein (His603-Gln979), N-MAT tagged | +Inquiry |
PTPRN-2900H | Recombinant Human PTPRN Protein (His215-Gln591), N-MAT tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRN-1440HCL | Recombinant Human PTPRN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTPRN Products
Required fields are marked with *
My Review for All PTPRN Products
Required fields are marked with *
0
Inquiry Basket