Recombinant Human PTPRN Protein, His-tagged

• Cat.No.: PTPRN-677H
• Product Overview: Recombinant Human PTPRN, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. Alternate splicing results in multiple transcript variants.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Supplied as a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH8.0
• Molecular Mass: 44.6kD
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMRQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVN
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Protein length: 20-255 a.a.

Gene Information

• Gene Name: PTPRN protein tyrosine phosphatase, receptor type, N [ Homo sapiens ]
• Official Symbol: PTPRN
• Synonyms: PTPRN; protein tyrosine phosphatase, receptor type, N; receptor-type tyrosine-protein phosphatase-like N; IA 2; ICA 512; PTP IA-2; islet cell antigen 2; islet cell antigen 512; islet cell autoantigen 3; protein tyrosine phosphatase-like N; IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; FLJ16131
• Gene ID: 5798
• mRNA Refseq: NM_001199763
• Protein Refseq: NP_001186692
• MIM: 601773
• UniProt ID: Q16849