Recombinant Human PTPRC, StrepII-tagged

Cat.No. : PTPRC-232H
Product Overview : Purified human recombinant receptor-type tyrosine-protein phosphatase C or CD45 protein (amino acids 598-1304, 707 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 81.5 kDa. (Accession NP_002829.2; UniProt P08575)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 598-1304, 707 a.a.
Description : This product is the intracellular domain of CD45, a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
AA Sequence : KIYDLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSIPRVFSKFPIKEARK PFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIV MVTRCEEGNRNKCAEYWPSMEEGTRAFGDVVVKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGV PEDPHLLLKLRRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVE AQYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHIGNQEENKSKNRN SNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIMSYWKPEVMIAAQGPLKETIGDFWQM IFQRKVKVIVMLTELKHGDQEICAQYWGEGKQTYGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTN WSVEQLPAEPKELISMIQVVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQ VVKALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDANCVNPLGAPEKLPEA KEQAEGSEPTSGTEGPEHSVNGPASPALNQGS
Endotoxin : <0.1 eu per ug protein by lal
Purity : >95% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name PTPRC protein tyrosine phosphatase, receptor type, C [ Homo sapiens ]
Official Symbol PTPRC
Synonyms PTPRC; protein tyrosine phosphatase, receptor type, C; CD45; receptor-type tyrosine-protein phosphatase C; GP180; LCA; T200; CD45 antigen; T200 glycoprotein; leukocyte common antigen; leukocyte-common antigen; T200 leukocyte common antigen; protein tyrosine phosphatase, receptor type, c polypeptide; LY5; B220; L-CA; CD45R;
Gene ID 5788
mRNA Refseq NM_002838
Protein Refseq NP_002829
MIM 151460
UniProt ID P08575
Chromosome Location 1q31-q32
Pathway Adaptive Immune System, organism-specific biosystem; Axon guidance, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; BCR signaling pathway, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem;
Function hydrolase activity; protein binding; protein kinase binding; protein tyrosine phosphatase activity; receptor activity; transmembrane receptor protein tyrosine phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PTPRC Products

Required fields are marked with *

My Review for All PTPRC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon