Recombinant Human PTPRC, StrepII-tagged

• Cat.No.: PTPRC-232H
• Product Overview: Purified human recombinant receptor-type tyrosine-protein phosphatase C or CD45 protein (amino acids 598-1304, 707 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 81.5 kDa. (Accession NP_002829.2; UniProt P08575)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 598-1304, 707 a.a.
• Description: This product is the intracellular domain of CD45, a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: KIYDLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSIPRVFSKFPIKEARK PFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIV MVTRCEEGNRNKCAEYWPSMEEGTRAFGDVVVKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGV PEDPHLLLKLRRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVE AQYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHIGNQEENKSKNRN SNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIMSYWKPEVMIAAQGPLKETIGDFWQM IFQRKVKVIVMLTELKHGDQEICAQYWGEGKQTYGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTN WSVEQLPAEPKELISMIQVVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQ VVKALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDANCVNPLGAPEKLPEA KEQAEGSEPTSGTEGPEHSVNGPASPALNQGS
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: PTPRC protein tyrosine phosphatase, receptor type, C [ Homo sapiens ]
• Official Symbol: PTPRC
• Synonyms: PTPRC; protein tyrosine phosphatase, receptor type, C; CD45; receptor-type tyrosine-protein phosphatase C; GP180; LCA; T200; CD45 antigen; T200 glycoprotein; leukocyte common antigen; leukocyte-common antigen; T200 leukocyte common antigen; protein tyrosine phosphatase, receptor type, c polypeptide; LY5; B220; L-CA; CD45R
• Gene ID: 5788
• mRNA Refseq: NM_002838
• Protein Refseq: NP_002829
• MIM: 151460
• UniProt ID: P08575
• Chromosome Location: 1q31-q32
• Pathway: Adaptive Immune System, organism-specific biosystem; Axon guidance, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; BCR signaling pathway, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem
• Function: hydrolase activity; protein binding; protein kinase binding; protein tyrosine phosphatase activity; receptor activity; transmembrane receptor protein tyrosine phosphatase activity