Recombinant Human PTPN23 Protein, GST-tagged

• Cat.No.: PTPN23-01H
• Product Overview: Human PTPN23 partial ORF ( NP_056281.1, 1233 a.a. - 1328 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the non-receptor type protein-tyrosine phosphatase family. The encoded protein may be involved in the regulation of small nuclear ribonucleo protein assembly and pre-mRNA splicing by modifying the survival motor neuron (SMN) complex. The encoded protein additionally plays a role in ciliogenesis and is part of endosomal sorting complex required for transport (ESCRT) pathways. This gene may serve a tumor suppressor function.
• Molecular Mass: 36.3 kDa
• AA Sequence: RVVLRSGKDDYINASCVEGLSPYCPPLVATQAPLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARYFPTERGQPMVHGALSLALSSVRSTET
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PTPN23 protein tyrosine phosphatase non-receptor type 23 [ Homo sapiens (human) ]
• Official Symbol: PTPN23
• Synonyms: PTPN23; protein tyrosine phosphatase non-receptor type 23; HDPTP; HD-PTP; NEDBASS; PTP-TD14; tyrosine-protein phosphatase non-receptor type 23; his domain-containing protein tyrosine phosphatase; protein tyrosine phosphatase TD14; EC 3.1.3.48
• Gene ID: 25930
• mRNA Refseq: NM_015466
• Protein Refseq: NP_056281
• MIM: 606584
• UniProt ID: Q9H3S7