Recombinant Human PTPN22 Protein (1-179), N-GST tagged

• Cat.No.: PTPN22-11H
• Product Overview: Human PTPN22 full-length ORF ( AAH17785, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Description: This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 45.43 kDa
• Protein length: 1-179
• AA Sequence: MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PTPN22 protein tyrosine phosphatase non-receptor type 22 [ Homo sapiens (human) ]
• Official Symbol: PTPN22
• Synonyms: PTPN22; protein tyrosine phosphatase non-receptor type 22; LYP; PEP; LYP1; LYP2; PTPN8; PTPN22.5; PTPN22.6; tyrosine-protein phosphatase non-receptor type 22; PEST-domain phosphatase; hematopoietic cell protein-tyrosine phosphatase 70Z-PEP; lymphoid-specific protein tyrosine phosphatase; protein tyrosine phosphatase, non-receptor type 22 (lymphoid); protein tyrosine phosphatase, non-receptor type 8; EC 3.1.3.48
• Gene ID: 26191
• mRNA Refseq: NM_015967
• Protein Refseq: NP_057051
• MIM: 600716
• UniProt ID: Q9Y2R2