Recombinant Human PTPMT1, His-tagged
Cat.No. : | PTPMT1-31117TH |
Product Overview : | Recombinant full length Human PTPMT1 with N terminal His tag; 199 amino acids with tag, Predicted MWt 22.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This protein phosphatase specifically mediates the dephosphorylation of mitochondrial proteins and consequently plays a central role in ATP production. |
Protein length : | 174 amino acids |
Conjugation : | HIS |
Molecular Weight : | 22.600kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMKVPGRAHRDWYHRID PTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCN SSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQ SLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAI AKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT |
Sequence Similarities : | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain. |
Gene Name | PTPMT1 protein tyrosine phosphatase, mitochondrial 1 [ Homo sapiens ] |
Official Symbol | PTPMT1 |
Synonyms | PTPMT1; protein tyrosine phosphatase, mitochondrial 1; protein-tyrosine phosphatase mitochondrial 1; DUSP23; MOSP; PLIP; |
Gene ID | 114971 |
mRNA Refseq | NM_001143984 |
Protein Refseq | NP_001137456 |
MIM | 609538 |
Uniprot ID | Q8WUK0 |
Chromosome Location | 11p11.2 |
Pathway | 3-phosphoinositide degradation, conserved biosystem; |
Function | hydrolase activity; phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PTPMT1 Products
Required fields are marked with *
My Review for All PTPMT1 Products
Required fields are marked with *
0
Inquiry Basket