Recombinant Human PTGR1 Protein, GST-tagged

• Cat.No.: PTGR1-4593H
• Product Overview: Human LTB4DH partial ORF ( NP_036344, 230 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is found on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: MKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PTGR1 prostaglandin reductase 1 [ Homo sapiens ]
• Official Symbol: PTGR1
• Synonyms: PTGR1; prostaglandin reductase 1; leukotriene B4 12 hydroxydehydrogenase , LTB4DH; ZADH3; zinc binding alcohol dehydrogenase domain containing 3; PRG-1; 15-oxoprostaglandin 13-reductase; leukotriene B4 12-hydroxydehydrogenase; NADP-dependent leukotriene B4 12-hydroxydehydrogenase; PGR1; LTB4DH; FLJ99229; MGC34943
• Gene ID: 22949
• mRNA Refseq: NM_001146108
• Protein Refseq: NP_001139580
• MIM: 601274
• UniProt ID: Q14914