Recombinant Human PTCD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PTCD2-5189H
• Product Overview: PTCD2 MS Standard C13 and N15-labeled recombinant protein (NP_079030) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: PTCD2 (Pentatricopeptide Repeat Domain 2) is a Protein Coding gene. Diseases associated with PTCD2 include Leigh Syndrome and Mitochondrial Metabolism Disease.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 43.8 kDa
• AA Sequence: MVRDSMAAAFRPSNRVLLQALQILVYPGVGGSGSVSCRCPLGAKRYLLTDNVVKLKEFQQKKVAVACNLSGTKETYFRNLKKKLTQNKLILKGELITLLHLCESRDHVELAKNVIYRYHAENKNFTLGEYKFGPLFVRLCYELDLEESAVELMKDQHLRGFFSDSTSFNILMDMLFIKGKYKSALQVLIEMKNQDVKFTKDTYVLAFAICYKLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLKNAAEGNLSKFVKRHVFSEEVLAKVREKVKDVPALVAKFDEIYGTLHITGQVTTDSLDAVLCHTPRDRKSHTLLLNKRMVSRRTFQPLSQSLLAETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PTCD2 pentatricopeptide repeat domain 2 [ Homo sapiens (human) ]
• Official Symbol: PTCD2
• Synonyms: PTCD2; pentatricopeptide repeat domain 2; pentatricopeptide repeat-containing protein 2; FLJ12598
• Gene ID: 79810
• mRNA Refseq: NM_024754
• Protein Refseq: NP_079030
• MIM: 615484
• UniProt ID: Q8WV60