Recombinant Human PSPN protein

• Cat.No.: PSPN-570H
• Product Overview: Recombinant Human PSPN protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 96
• Description: This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Elevated expression of this gene has been observed in oral squamous cell carcinoma.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TT medullary thyroid cancer cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg.
• Molecular Mass: Approximately 20.5 kDa, a disulfide-linked homodimer of two 96 amino acid polypeptide chains.
• AA Sequence: ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG
• Endotoxin: Less than 0.1 EU/µg of rHuPersephin as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4 mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: PSPN
• Official Symbol: PSPN
• Synonyms: PSPN; persephin; PSP
• Gene ID: 5623
• mRNA Refseq: NM_004158
• Protein Refseq: NP_004149
• MIM: 602921
• UniProt ID: P06734